Lineage for d1k51a_ (1k51 A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 131315Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 131316Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)
  6. 131317Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)
  7. 131318Species Peptostreptococcus magnus [TaxId:1260] [54363] (10 PDB entries)
  8. 131326Domain d1k51a_: 1k51 A: [68147]

Details for d1k51a_

PDB Entry: 1k51 (more details), 1.8 Å

PDB Description: A G55A Mutation Induces 3D Domain Swapping in the B1 Domain of Protein L from Peptostreptococcus magnus
PDB Compounds: (A:)

SCOP Domain Sequences for d1k51a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k51a_ d.15.7.1 (A:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus}
mhhhhhhameevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdva
dkaytlnikfag

SCOP Domain Coordinates for d1k51a_:

Click to download the PDB-style file with coordinates for d1k51a_.
(The format of our PDB-style files is described here.)

Timeline for d1k51a_: