Lineage for d1k50b_ (1k50 B:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325904Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 325905Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)
  6. 325906Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)
  7. 325907Species Peptostreptococcus magnus [TaxId:1260] [54363] (11 PDB entries)
  8. 325917Domain d1k50b_: 1k50 B: [68144]

Details for d1k50b_

PDB Entry: 1k50 (more details), 1.8 Å

PDB Description: A V49A Mutation Induces 3D Domain Swapping in the B1 Domain of Protein L from Peptostreptococcus magnus
PDB Compounds: (B:)

SCOP Domain Sequences for d1k50b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k50b_ d.15.7.1 (B:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus}
eevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtadvadkgytlnik
fag

SCOP Domain Coordinates for d1k50b_:

Click to download the PDB-style file with coordinates for d1k50b_.
(The format of our PDB-style files is described here.)

Timeline for d1k50b_: