Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) |
Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins) |
Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species) |
Species Peptostreptococcus magnus [TaxId:1260] [54363] (10 PDB entries) |
Domain d1k50b_: 1k50 B: [68144] |
PDB Entry: 1k50 (more details), 1.8 Å
SCOP Domain Sequences for d1k50b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k50b_ d.15.7.1 (B:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus} eevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtadvadkgytlnik fag
Timeline for d1k50b_: