Lineage for d1k50a_ (1k50 A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253998Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 254500Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 254501Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)
  6. 254502Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)
  7. 254503Species Peptostreptococcus magnus [TaxId:1260] [54363] (11 PDB entries)
  8. 254512Domain d1k50a_: 1k50 A: [68143]

Details for d1k50a_

PDB Entry: 1k50 (more details), 1.8 Å

PDB Description: a v49a mutation induces 3d domain swapping in the b1 domain of protein l from peptostreptococcus magnus

SCOP Domain Sequences for d1k50a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k50a_ d.15.7.1 (A:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus}
eevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtadvadkgytlnik
fag

SCOP Domain Coordinates for d1k50a_:

Click to download the PDB-style file with coordinates for d1k50a_.
(The format of our PDB-style files is described here.)

Timeline for d1k50a_: