Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) both first two domains are of same beta/beta/alpha fold |
Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (10 proteins) |
Protein Glutathione reductase [55426] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [55427] (17 PDB entries) |
Domain d1k4qa3: 1k4q A:364-478 [68142] Other proteins in same PDB: d1k4qa1, d1k4qa2 |
PDB Entry: 1k4q (more details), 1.9 Å
SCOP Domain Sequences for d1k4qa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k4qa3 d.87.1.1 (A:364-478) Glutathione reductase {Human (Homo sapiens)} ynniptvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvc ankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr
Timeline for d1k4qa3: