Lineage for d1k4qa2 (1k4q A:166-290)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119015Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 119016Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 119206Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
  6. 119258Protein Glutathione reductase [51944] (2 species)
  7. 119276Species Human (Homo sapiens) [TaxId:9606] [51945] (17 PDB entries)
  8. 119286Domain d1k4qa2: 1k4q A:166-290 [68141]
    Other proteins in same PDB: d1k4qa3

Details for d1k4qa2

PDB Entry: 1k4q (more details), 1.9 Å

PDB Description: Human Glutathione Reductase Inactivated by Peroxynitrite

SCOP Domain Sequences for d1k4qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4qa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens)}
sqipgaslgitsdgffqleelpgrsvivgagyiavemagilsalgsktslmirhdkvlrs
fdsmistncteelenagvevlkfsqvkevkktlsglevsmvtavpgrlpvmtmipdvdcl
lwaig

SCOP Domain Coordinates for d1k4qa2:

Click to download the PDB-style file with coordinates for d1k4qa2.
(The format of our PDB-style files is described here.)

Timeline for d1k4qa2: