| Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
| Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) ![]() |
| Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins) |
| Protein Glutathione reductase [51944] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [51945] (17 PDB entries) |
| Domain d1k4qa2: 1k4q A:166-290 [68141] Other proteins in same PDB: d1k4qa3 |
PDB Entry: 1k4q (more details), 1.9 Å
SCOP Domain Sequences for d1k4qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k4qa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens)}
sqipgaslgitsdgffqleelpgrsvivgagyiavemagilsalgsktslmirhdkvlrs
fdsmistncteelenagvevlkfsqvkevkktlsglevsmvtavpgrlpvmtmipdvdcl
lwaig
Timeline for d1k4qa2: