Lineage for d1k4qa1 (1k4q A:18-165,A:291-363)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) 
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins) Protein Glutathione reductase [51944] (2 species) Species Human (Homo sapiens) [TaxId:9606] [51945] (17 PDB entries) 
Domain d1k4qa1: 1k4q A:18-165,A:291-363 [68140]
Other proteins in same PDB: d1k4qa3
Details for d1k4qa1
PDB Entry: 1k4q (more details), 1.9 Å
PDB Description: Human Glutathione Reductase Inactivated by Peroxynitrite
SCOP Domain Sequences for d1k4qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k4qa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens)}
vasydylvigggsgglasarraaelgaraavveshklggtcvnvgcvpkkvmwntavhse
fmhdhadygfpscegkfnwrvikekrdayvsrlnaiyqnnltkshieiirghaaftsdpk
ptievsgkkytaphiliatggmpstpheXrvpntkdlslnklgiqtddkghiivdefqnt
nvkgiyavgdvcgkalltpvaiaagrklahrlfeykedskld
SCOP Domain Coordinates for d1k4qa1:
Click to download the PDB-style file with coordinates for d1k4qa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k4qa1:
- d1k4qa1 is new in SCOP 1.59
- d1k4qa1 appears in SCOP 1.61
- d1k4qa1 appears in the current release, SCOPe 2.08
View in 3D
