| Class b: All beta proteins [48724] (126 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries) |
| Domain d1k4db2: 1k4d B:108-212 [68134] Other proteins in same PDB: d1k4da1, d1k4da2, d1k4db1, d1k4dc_ part of Fab against potassium channel KcsA complexed with dga, f09, k, na; mutant |
PDB Entry: 1k4d (more details), 2.3 Å
SCOP Domain Sequences for d1k4db2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k4db2 b.1.1.2 (B:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d1k4db2: