![]() | Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
![]() | Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily) oligomeric transmembrane alpha-helical proteins |
![]() | Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) ![]() |
![]() | Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins) |
![]() | Protein Potassium channel protein [56901] (2 species) |
![]() | Species Streptomyces coelicolor [TaxId:1902] [56902] (28 PDB entries) identical sequence to Streptomyces lividans, TaxId: 1916 Uniprot Q54397 22-124 |
![]() | Domain d1k4cc_: 1k4c C: [68130] Other proteins in same PDB: d1k4ca1, d1k4ca2, d1k4cb1, d1k4cb2 residues 22-124 complexed with dga, f09, k; mutant |
PDB Entry: 1k4c (more details), 2 Å
SCOP Domain Sequences for d1k4cc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k4cc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d1k4cc_:
![]() Domains from other chains: (mouse over for more information) d1k4ca1, d1k4ca2, d1k4cb1, d1k4cb2 |