Lineage for d1k4cc_ (1k4c C:)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 340499Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 340500Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 340501Family f.14.1.1: Voltage-gated potassium channels [81323] (4 proteins)
  6. 340510Protein Potassium channel protein [56901] (1 species)
  7. 340511Species Streptomyces lividans [TaxId:1916] [56902] (8 PDB entries)
  8. 340512Domain d1k4cc_: 1k4c C: [68130]
    Other proteins in same PDB: d1k4ca1, d1k4ca2, d1k4cb1, d1k4cb2
    residues 22-124
    complexed with dga, f09, k; mutant

Details for d1k4cc_

PDB Entry: 1k4c (more details), 2 Å

PDB Description: potassium channel kcsa-fab complex in high concentration of k+

SCOP Domain Sequences for d1k4cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4cc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOP Domain Coordinates for d1k4cc_:

Click to download the PDB-style file with coordinates for d1k4cc_.
(The format of our PDB-style files is described here.)

Timeline for d1k4cc_: