SCOP 1.63: Domain d1k4cc_: 1k4c C:

Lineage for d1k4cc_ (1k4c C:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (2 proteins)

6. Protein Potassium channel protein [56901] (1 species)

7. Species Streptomyces lividans [TaxId:1916] [56902] (8 PDB entries)

8. Domain d1k4cc_: 1k4c C: [68130]
   Other proteins in same PDB: d1k4ca1, d1k4ca2, d1k4cb1, d1k4cb2
   residues 22-124
   complexed with dga, f09, k; mutant

Details for d1k4cc_

PDB Entry: 1k4c, 2 Å

PDB Description: potassium channel kcsa-fab complex in high concentration of k+

SCOP Domain Sequences for d1k4cc_:

Sequence; same for both SEQRES and ATOM records:

>d1k4cc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d1k4cc_:

• d1k4cc_ first appeared in SCOP 1.59
  
• d1k4cc_ appears in SCOP 1.61
  
• d1k4cc_ appears in SCOP 1.65
  
• d1k4cc_ appears in the current release, SCOPe 2.08