Lineage for d1k4cc_ (1k4c C:)

  1. Root: SCOP 1.59
  2. 141686Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 141752Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 141753Superfamily f.2.1: Membrane all-alpha [56869] (11 families) (S)
  5. 142172Family f.2.1.11: Oligomeric gated channels [63383] (3 proteins)
  6. 142180Protein Potassium chanel protein [56901] (1 species)
  7. 142181Species Streptomyces lividans [TaxId:1916] [56902] (8 PDB entries)
  8. 142182Domain d1k4cc_: 1k4c C: [68130]
    Other proteins in same PDB: d1k4ca1, d1k4ca2, d1k4cb1, d1k4cb2

Details for d1k4cc_

PDB Entry: 1k4c (more details), 2 Å

PDB Description: Potassium Channel KcsA-Fab complex in high concentration of K+

SCOP Domain Sequences for d1k4cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4cc_ f.2.1.11 (C:) Potassium chanel protein {Streptomyces lividans}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOP Domain Coordinates for d1k4cc_:

Click to download the PDB-style file with coordinates for d1k4cc_.
(The format of our PDB-style files is described here.)

Timeline for d1k4cc_: