Lineage for d1k4cb2 (1k4c B:108-212)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656185Domain d1k4cb2: 1k4c B:108-212 [68129]
    Other proteins in same PDB: d1k4ca1, d1k4ca2, d1k4cb1, d1k4cc_
    part of Fab against potassium channel KcsA
    complexed with dga, f09, k; mutant

Details for d1k4cb2

PDB Entry: 1k4c (more details), 2 Å

PDB Description: Potassium Channel KcsA-Fab complex in high concentration of K+
PDB Compounds: (B:) antibody fab fragment light chain

SCOP Domain Sequences for d1k4cb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4cb2 b.1.1.2 (B:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOP Domain Coordinates for d1k4cb2:

Click to download the PDB-style file with coordinates for d1k4cb2.
(The format of our PDB-style files is described here.)

Timeline for d1k4cb2: