SCOP 1.71: Domain d1k4cb2: 1k4c B:108-212

Lineage for d1k4cb2 (1k4c B:108-212)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries)

8. Domain d1k4cb2: 1k4c B:108-212 [68129]
   Other proteins in same PDB: d1k4ca1, d1k4ca2, d1k4cb1, d1k4cc_
   part of Fab against potassium channel KcsA
   complexed with dga, f09, k; mutant

Details for d1k4cb2

PDB Entry: 1k4c, 2 Å

PDB Description: Potassium Channel KcsA-Fab complex in high concentration of K+

SCOP Domain Sequences for d1k4cb2:

Sequence; same for both SEQRES and ATOM records:

>d1k4cb2 b.1.1.2 (B:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d1k4cb2:

• d1k4cb2 first appeared in SCOP 1.59
  
• d1k4cb2 appears in SCOP 1.69
  
• d1k4cb2 appears in SCOP 1.73
  
• d1k4cb2 appears in the current release, SCOPe 2.07