SCOP 1.59: Domain d1k4cb1: 1k4c B:1-107

Lineage for d1k4cb1 (1k4c B:1-107)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Fab against potassium channel KcsA, (mouse), kappa L chain [69140] (2 PDB entries)

8. Domain d1k4cb1: 1k4c B:1-107 [68128]
   Other proteins in same PDB: d1k4ca2, d1k4cb2, d1k4cc_

Details for d1k4cb1

PDB Entry: 1k4c, 2 Å

PDB Description: Potassium Channel KcsA-Fab complex in high concentration of K+

SCOP Domain Sequences for d1k4cb1:

Sequence; same for both SEQRES and ATOM records:

>d1k4cb1 b.1.1.1 (B:1-107) Immunoglobulin (variable domains of L and H chains) {Fab against potassium channel KcsA, (mouse), kappa L chain}
dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleik

Timeline for d1k4cb1:

• d1k4cb1 is new in SCOP 1.59
  
• d1k4cb1 appears in SCOP 1.61
  
• d1k4cb1 appears in the current release, SCOPe 2.07