SCOP 1.69: Domain d1k4ca2: 1k4c A:119-219

Lineage for d1k4ca2 (1k4c A:119-219)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)

8. Domain d1k4ca2: 1k4c A:119-219 [68127]
   Other proteins in same PDB: d1k4ca1, d1k4cb1, d1k4cb2, d1k4cc_
   part of Fab against potassium channel KcsA

Details for d1k4ca2

PDB Entry: 1k4c, 2 Å

PDB Description: potassium channel kcsa-fab complex in high concentration of k+

SCOP Domain Sequences for d1k4ca2:

Sequence; same for both SEQRES and ATOM records:

>d1k4ca2 b.1.1.2 (A:119-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssswpsetvtcnvahpasstkvdkkivprd

Timeline for d1k4ca2:

• d1k4ca2 first appeared in SCOP 1.59
  
• d1k4ca2 appears in SCOP 1.67
  
• d1k4ca2 appears in SCOP 1.71
  
• d1k4ca2 appears in the current release, SCOPe 2.08