SCOP 1.63: Domain d1k4ca2: 1k4c A:119-219

Lineage for d1k4ca2 (1k4c A:119-219)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab against potassium channel KcsA, (mouse), kappa L chain [69151] (2 PDB entries)

8. Domain d1k4ca2: 1k4c A:119-219 [68127]
   Other proteins in same PDB: d1k4ca1, d1k4cb1, d1k4cc_

Details for d1k4ca2

PDB Entry: 1k4c, 2 Å

PDB Description: potassium channel kcsa-fab complex in high concentration of k+

SCOP Domain Sequences for d1k4ca2:

Sequence; same for both SEQRES and ATOM records:

>d1k4ca2 b.1.1.2 (A:119-219) Immunoglobulin (constant domains of L and H chains) {Fab against potassium channel KcsA, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssswpsetvtcnvahpasstkvdkkivprd

Timeline for d1k4ca2:

• d1k4ca2 first appeared in SCOP 1.59
  
• d1k4ca2 appears in SCOP 1.61
  
• d1k4ca2 appears in SCOP 1.65
  
• d1k4ca2 appears in the current release, SCOPe 2.08