Lineage for d1k40a_ (1k40 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1988065Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (2 families) (S)
  5. 1988066Family a.24.14.1: FAT domain of focal adhesion kinase [68994] (2 protein domains)
    automatically mapped to Pfam PF03623
  6. 1988067Protein FAT domain of focal adhesion kinase [68995] (3 species)
  7. 1988086Species Mouse (Mus musculus) [TaxId:10090] [68997] (1 PDB entry)
  8. 1988087Domain d1k40a_: 1k40 A: [68123]

Details for d1k40a_

PDB Entry: 1k40 (more details), 2.25 Å

PDB Description: crystal structure of the FAT domain of focal adhesion kinase
PDB Compounds: (A:) adhesion kinase

SCOPe Domain Sequences for d1k40a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k40a_ a.24.14.1 (A:) FAT domain of focal adhesion kinase {Mouse (Mus musculus) [TaxId: 10090]}
ndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtllatvdetipalpasth
reiemaqkllnsdlgeliskmklaqqyvmtslqqeykkqmltaahalavdaknlldvidq
arlkml

SCOPe Domain Coordinates for d1k40a_:

Click to download the PDB-style file with coordinates for d1k40a_.
(The format of our PDB-style files is described here.)

Timeline for d1k40a_: