Lineage for d1k3va_ (1k3v A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2076263Superfamily b.121.5: ssDNA viruses [88645] (3 families) (S)
  5. 2076282Family b.121.5.2: Parvoviridae-like VP [88646] (3 protein domains)
    automatically mapped to Pfam PF00740
  6. 2076286Protein Parvovirus (panleukopenia virus) capsid protein [49661] (6 species)
  7. 2076306Species Porcine parvovirus [TaxId:10796] [69201] (1 PDB entry)
  8. 2076307Domain d1k3va_: 1k3v A: [68122]

Details for d1k3va_

PDB Entry: 1k3v (more details), 3.5 Å

PDB Description: Porcine Parvovirus Capsid
PDB Compounds: (A:) capsid protein VP2

SCOPe Domain Sequences for d1k3va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3va_ b.121.5.2 (A:) Parvovirus (panleukopenia virus) capsid protein {Porcine parvovirus [TaxId: 10796]}
gvgvstgtfnnqtefqylgeglvritahasrlihlnmpehetykrihvlnsesgvagqmv
qddahtqmvtpwslidanawgvwfnpadwqlisnnmteinlvsfeqeifnvvlktitesa
tspptkiynndltaslmvaldtnntlpytpaaprsetlgfypwlptkptqyryylscirn
lnpptytgqsqqitdsiqtglhsdimfytienavpihllrtgdefstgiyhfdtkplklt
hswqtnrslglppklltepttegdqhpgtlpaantrkgyhqtinnsyteatairpaqvgy
ntpymnfeysnggpfltpivptadtqynddepngairftmdyqhghlttssqelerytfn
pqskcgrapkqqfnqqaplnlentnngtllpsdpiggksnmhfmntlntygpltalnnta
pvfpngqiwdkeldtdlkprlhvtapfvcknnppgqlfvkiapnltddfnadspqqprii
tysnfwwkgtltftakmrssnmwnpiqqhtttaenignyiptniggirmfpeysqliprk
ly

SCOPe Domain Coordinates for d1k3va_:

Click to download the PDB-style file with coordinates for d1k3va_.
(The format of our PDB-style files is described here.)

Timeline for d1k3va_: