SCOPe 2.05: Domain d1k3qa_: 1k3q A:

Lineage for d1k3qa_ (1k3q A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.2: FHA domain [49885] (12 proteins)

6. Protein Phosphotyrosine binding domain of Rad53 [49886] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49887] (18 PDB entries)

8. Domain d1k3qa_: 1k3q A: [68119]
   complex with a rad9-derived phosphothreonine peptide

Details for d1k3qa_

PDB Entry: 1k3q

PDB Description: nmr structure of the fha1 domain of rad53 in complex with a rad9- derived phosphothreonine (at t192) peptide

PDB Compounds: (A:) protein kinase spk1

SCOPe Domain Sequences for d1k3qa_:

Sequence; same for both SEQRES and ATOM records:

>d1k3qa_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atqrfliekfsqeqigenivcrvicttgqipirdlsadisqvlkekrsikkvwtfgrnpa
cdyhlgnisrlsnkhfqillgedgnlllndistngtwlngqkveknsnqllsqgdeitvg
vgvesdilslvifindkfkqcleqnkvdrir

Timeline for d1k3qa_:

• d1k3qa_ first appeared in SCOP 1.59
  
• d1k3qa_ appears in SCOPe 2.04
  
• d1k3qa_ appears in SCOPe 2.06
  
• d1k3qa_ appears in the current release, SCOPe 2.08