Lineage for d1k3ja_ (1k3j A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779760Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 1779761Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 1779795Family b.26.1.2: FHA domain [49885] (12 proteins)
  6. 1779823Protein Phosphotyrosine binding domain of Rad53 [49886] (1 species)
  7. 1779824Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49887] (18 PDB entries)
  8. 1779828Domain d1k3ja_: 1k3j A: [68116]

Details for d1k3ja_

PDB Entry: 1k3j (more details)

PDB Description: refined nmr structure of the fha1 domain of yeast rad53
PDB Compounds: (A:) protein kinase spk1

SCOPe Domain Sequences for d1k3ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3ja_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atqrfliekfsqeqigenivcrvicttgqipirdlsadisqvlkekrsikkvwtfgrnpa
cdyhlgnisrlsnkhfqillgedgnlllndistngtwlngqkveknsnqllsqgdeitvg
vgvesdilslvifindkfkqcleqnkvdrir

SCOPe Domain Coordinates for d1k3ja_:

Click to download the PDB-style file with coordinates for d1k3ja_.
(The format of our PDB-style files is described here.)

Timeline for d1k3ja_: