Lineage for d1k3ia2 (1k3i A:-12-150)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 107983Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
  4. 107984Superfamily b.18.1: Galactose-binding domain-like [49785] (13 families) (S)
  5. 107985Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)
  6. 107986Protein Galactose oxidase, N-terminal domain [49787] (2 species)
  7. 107991Species Fungi (Fusarium spp) [69209] (1 PDB entry)
  8. 107992Domain d1k3ia2: 1k3i A:-12-150 [68114]
    Other proteins in same PDB: d1k3ia1, d1k3ia3

Details for d1k3ia2

PDB Entry: 1k3i (more details), 1.4 Å

PDB Description: crystal structure of the precursor of galactose oxidase

SCOP Domain Sequences for d1k3ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3ia2 b.18.1.1 (A:-12-150) Galactose oxidase, N-terminal domain {Fungi (Fusarium spp)}
ipegslqflslrasapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangd
pkpphtytidmkttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfad
sttkysnfetrparyvrlvaiteangqpwtsiaeinvfqass

SCOP Domain Coordinates for d1k3ia2:

Click to download the PDB-style file with coordinates for d1k3ia2.
(The format of our PDB-style files is described here.)

Timeline for d1k3ia2: