Lineage for d1k3ia1 (1k3i A:538-639)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2038694Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 2038814Protein Galactose oxidase, C-terminal domain [49209] (3 species)
    follows the catalytic seven-bladed beta-propeller domain
  7. 2038819Species Fungus (Fusarium sp.) [TaxId:29916] [69164] (2 PDB entries)
    sequence identical to that of Dactylium dendroides
  8. 2038820Domain d1k3ia1: 1k3i A:538-639 [68113]
    Other proteins in same PDB: d1k3ia2, d1k3ia3
    complexed with act, ca, glc

Details for d1k3ia1

PDB Entry: 1k3i (more details), 1.4 Å

PDB Description: crystal structure of the precursor of galactose oxidase
PDB Compounds: (A:) Galactose Oxidase Precursor

SCOPe Domain Sequences for d1k3ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3ia1 b.1.18.2 (A:538-639) Galactose oxidase, C-terminal domain {Fungus (Fusarium sp.) [TaxId: 29916]}
gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn
ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq

SCOPe Domain Coordinates for d1k3ia1:

Click to download the PDB-style file with coordinates for d1k3ia1.
(The format of our PDB-style files is described here.)

Timeline for d1k3ia1: