SCOP 1.73: Domain d1k3ia1: 1k3i A:538-639

Lineage for d1k3ia1 (1k3i A:538-639)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (19 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Galactose oxidase, C-terminal domain [49209] (2 species)
   follows the catalytic seven-bladed beta-propeller domain

7. Species Fungi (Fusarium sp.) [TaxId:29916] [69164] (1 PDB entry)
   sequence identical to that of Dactylium dendroides

8. Domain d1k3ia1: 1k3i A:538-639 [68113]
   Other proteins in same PDB: d1k3ia2, d1k3ia3
   complexed with act, ca, glc

Details for d1k3ia1

PDB Entry: 1k3i, 1.4 Å

PDB Description: crystal structure of the precursor of galactose oxidase

PDB Compounds: (A:) Galactose Oxidase Precursor

SCOP Domain Sequences for d1k3ia1:

Sequence; same for both SEQRES and ATOM records:

>d1k3ia1 b.1.18.2 (A:538-639) Galactose oxidase, C-terminal domain {Fungi (Fusarium sp.) [TaxId: 29916]}
gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn
ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq

Timeline for d1k3ia1:

• d1k3ia1 first appeared in SCOP 1.59
  
• d1k3ia1 appears in SCOP 1.71
  
• d1k3ia1 appears in SCOP 1.75
  
• d1k3ia1 appears in the current release, SCOPe 2.08