![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (11 species) |
![]() | Species Bacillus pasteurii [TaxId:1474] [46629] (5 PDB entries) |
![]() | Domain d1k3ga_: 1k3g A: [68111] complexed with hec |
PDB Entry: 1k3g (more details)
SCOPe Domain Sequences for d1k3ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k3ga_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Bacillus pasteurii [TaxId: 1474]} vdaeavvqqkcischggdltgasapaidkaganyseeeildiilngqggmpggiakgaea eavaawlaekk
Timeline for d1k3ga_: