Lineage for d1k3ff_ (1k3f F:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) 
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) 
Family c.56.2.1: Purine and uridine phosphorylases [53168] (3 proteins) 
Protein Uridine phosphorylase [53176] (1 species) Species Escherichia coli [TaxId:562] [53177] (1 PDB entry) 
Domain d1k3ff_: 1k3f F: [68110]
Details for d1k3ff_
PDB Entry: 1k3f (more details), 2.5 Å
PDB Description: Uridine Phosphorylase from E. coli, Refined in the Monoclinic Crystal Lattice
SCOP Domain Sequences for d1k3ff_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k3ff_ c.56.2.1 (F:) Uridine phosphorylase {Escherichia coli}
msksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgk
pvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
lhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhf
kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
avkivveaarrll
SCOP Domain Coordinates for d1k3ff_:
Click to download the PDB-style file with coordinates for d1k3ff_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k3ff_:
- d1k3ff_ is new in SCOP 1.59
- d1k3ff_ appears in SCOP 1.61
- d1k3ff_ appears in the current release, SCOPe 2.08
View in 3D
