SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1k3ff_ (1k3f F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2125403Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2125404Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 protein domains)
  6. 2125805Protein Uridine phosphorylase [53176] (6 species)
  7. 2125806Species Escherichia coli [TaxId:562] [53177] (16 PDB entries)
  8. 2125890Domain d1k3ff_: 1k3f F: [68110]

Details for d1k3ff_

PDB Entry: 1k3f (more details), 2.5 Å

PDB Description: Uridine Phosphorylase from E. coli, Refined in the Monoclinic Crystal Lattice
PDB Compounds: (F:) Uridine phosphorylase

SCOPe Domain Sequences for d1k3ff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3ff_ c.56.2.1 (F:) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
msksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgk
pvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
lhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhf
kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
avkivveaarrll

SCOPe Domain Coordinates for d1k3ff_:

Click to download the PDB-style file with coordinates for d1k3ff_.
(The format of our PDB-style files is described here.)

Timeline for d1k3ff_: