Lineage for d1k3fe_ (1k3f E:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 996821Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 996837Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 996838Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 997163Protein Uridine phosphorylase [53176] (2 species)
  7. 997164Species Escherichia coli [TaxId:562] [53177] (15 PDB entries)
  8. 997245Domain d1k3fe_: 1k3f E: [68109]

Details for d1k3fe_

PDB Entry: 1k3f (more details), 2.5 Å

PDB Description: Uridine Phosphorylase from E. coli, Refined in the Monoclinic Crystal Lattice
PDB Compounds: (E:) Uridine phosphorylase

SCOPe Domain Sequences for d1k3fe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3fe_ c.56.2.1 (E:) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
msksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgk
pvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
lhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhf
kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
avkivveaarrll

SCOPe Domain Coordinates for d1k3fe_:

Click to download the PDB-style file with coordinates for d1k3fe_.
(The format of our PDB-style files is described here.)

Timeline for d1k3fe_: