SCOP 1.69: Domain d1k3fb_: 1k3f B:

Lineage for d1k3fb_ (1k3f B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)

6. Protein Uridine phosphorylase [53176] (1 species)

7. Species Escherichia coli [TaxId:562] [53177] (6 PDB entries)
   also includes the PDB entry (1rxs) where protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP

8. Domain d1k3fb_: 1k3f B: [68106]

Details for d1k3fb_

PDB Entry: 1k3f, 2.5 Å

PDB Description: Uridine Phosphorylase from E. coli, Refined in the Monoclinic Crystal Lattice

SCOP Domain Sequences for d1k3fb_:

Sequence; same for both SEQRES and ATOM records:

>d1k3fb_ c.56.2.1 (B:) Uridine phosphorylase {Escherichia coli}
msksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgk
pvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
lhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhf
kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
avkivveaarrll

Timeline for d1k3fb_:

• d1k3fb_ first appeared in SCOP 1.59
  
• d1k3fb_ appears in SCOP 1.67
  
• d1k3fb_ appears in SCOP 1.71
  
• d1k3fb_ appears in the current release, SCOPe 2.08