Lineage for d1k3da2 (1k3d A:6-227)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1884249Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 1884250Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 1884251Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)
  6. 1884302Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (4 species)
  7. 1884306Species Escherichia coli [TaxId:562] [68926] (10 PDB entries)
  8. 1884313Domain d1k3da2: 1k3d A:6-227 [68102]
    Other proteins in same PDB: d1k3da1
    complexed with adp, af3, mg

Details for d1k3da2

PDB Entry: 1k3d (more details), 2 Å

PDB Description: Phosphoenolpyruvate carboxykinase in complex with ADP and AlF3
PDB Compounds: (A:) phosphoenolpyruvate carboxykinase

SCOPe Domain Sequences for d1k3da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3da2 c.109.1.1 (A:6-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]}
gltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgr
spkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafc
ganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgl
nsenfvafnltermqliggtwyggemkkgmfsmmnyllplkg

SCOPe Domain Coordinates for d1k3da2:

Click to download the PDB-style file with coordinates for d1k3da2.
(The format of our PDB-style files is described here.)

Timeline for d1k3da2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k3da1