Lineage for d1k35a2 (1k35 A:155-258)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 127595Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
  4. 127596Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) (S)
  5. 127597Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)
  6. 127650Protein Phosphomannomutase/phosphoglucomutase [69607] (1 species)
  7. 127651Species Pseudomonas aeruginosa [TaxId:287] [69608] (2 PDB entries)
  8. 127657Domain d1k35a2: 1k35 A:155-258 [68095]

Details for d1k35a2

PDB Entry: 1k35 (more details), 2.2 Å

PDB Description: Crystal Structure of Phosphomannomutase/Phosphoglucomutase from P.aeruginosa

SCOP Domain Sequences for d1k35a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k35a2 c.84.1.1 (A:155-258) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa}
ilpryfkqirddiamakpmkvvvdcgngvagviapqliealgcsviplycevdgnfpnhh
pdpgkpenlkdliakvkaenadlglafdgdgdrvgvvtntgtii

SCOP Domain Coordinates for d1k35a2:

Click to download the PDB-style file with coordinates for d1k35a2.
(The format of our PDB-style files is described here.)

Timeline for d1k35a2: