SCOP 1.63: Domain d1k33a_: 1k33 A:

Lineage for d1k33a_ (1k33 A:)

1. Root: SCOP 1.63

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (1 family)

5. Family h.3.2.1: Virus ectodomain [58070] (6 proteins)

6. Protein Retrovius gp41 protease-resistant core [58071] (3 species)
   coiled coil; biological unit: trimer

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (16 PDB entries)

8. Domain d1k33a_: 1k33 A: [68092]

Details for d1k33a_

PDB Entry: 1k33, 1.75 Å

PDB Description: crystal structure analysis of the gp41 core mutant

SCOP Domain Sequences for d1k33a_:

Sequence, based on SEQRES records:

>d1k33a_ h.3.2.1 (A:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1}
sgivqqqnnllraieaqqhllqltvwgikqlqarsggrggwmewdreannytslihslie
esqnqq

Sequence, based on observed residues (ATOM records):

>d1k33a_ h.3.2.1 (A:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1}
sgivqqqnnllraieaqqhllqltvwgikqlqgrggwmewdreannytslihslieesqn
qq

Timeline for d1k33a_:

• d1k33a_ first appeared in SCOP 1.59
  
• d1k33a_ appears in SCOP 1.61
  
• d1k33a_ appears in SCOP 1.65
  
• d1k33a_ appears in the current release, SCOPe 2.08