Lineage for d1k32f2 (1k32 F:39-319)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 233193Fold b.68: 6-bladed beta-propeller [50938] (7 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 233344Superfamily b.68.7: Tricorn protease N-terminal domain [69304] (1 family) (S)
    possibly related to the second domain of tricorn protease (a distorted 7-bladed beta-propeller)
  5. 233345Family b.68.7.1: Tricorn protease N-terminal domain [69305] (1 protein)
  6. 233346Protein Tricorn protease N-terminal domain [69306] (1 species)
  7. 233347Species Archaeon Thermoplasma acidophilum [TaxId:2303] [69307] (4 PDB entries)
  8. 233353Domain d1k32f2: 1k32 F:39-319 [68089]
    Other proteins in same PDB: d1k32a1, d1k32a3, d1k32a4, d1k32b1, d1k32b3, d1k32b4, d1k32c1, d1k32c3, d1k32c4, d1k32d1, d1k32d3, d1k32d4, d1k32e1, d1k32e3, d1k32e4, d1k32f1, d1k32f3, d1k32f4

Details for d1k32f2

PDB Entry: 1k32 (more details), 2 Å

PDB Description: Crystal structure of the tricorn protease

SCOP Domain Sequences for d1k32f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k32f2 b.68.7.1 (F:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum}
mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
ntdgrrilfskggsiyifnpdtekiekieigdlespedrii

SCOP Domain Coordinates for d1k32f2:

Click to download the PDB-style file with coordinates for d1k32f2.
(The format of our PDB-style files is described here.)

Timeline for d1k32f2: