Lineage for d1k32d3 (1k32 D:320-679)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 233372Fold b.69: 7-bladed beta-propeller [50964] (10 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 233511Superfamily b.69.9: Tricorn protease N-terminal domain [69322] (1 family) (S)
    distorted 7-bladed beta-propeller fold; possibly related to the N-terminal domain of tricorn protease (a distorted 7-bladed beta-propeller)
  5. 233512Family b.69.9.1: Tricorn protease N-terminal domain [69323] (1 protein)
  6. 233513Protein Tricorn protease N-terminal domain [69324] (1 species)
  7. 233514Species Archaeon Thermoplasma acidophilum [TaxId:2303] [69325] (4 PDB entries)
  8. 233518Domain d1k32d3: 1k32 D:320-679 [68082]
    Other proteins in same PDB: d1k32a1, d1k32a2, d1k32a4, d1k32b1, d1k32b2, d1k32b4, d1k32c1, d1k32c2, d1k32c4, d1k32d1, d1k32d2, d1k32d4, d1k32e1, d1k32e2, d1k32e4, d1k32f1, d1k32f2, d1k32f4

Details for d1k32d3

PDB Entry: 1k32 (more details), 2 Å

PDB Description: Crystal structure of the tricorn protease

SCOP Domain Sequences for d1k32d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k32d3 b.69.9.1 (D:320-679) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum}
sipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafih
gtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfavvandrfeimtvdletgkpt
viersreamitdftisdnsrfiaygfplkhgetdgyvmqaihvydmegrkifaattensh
dyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpfviplipgspnptklvprsm
tseageydlndmykrsspinvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvl
lkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytfplekpedertvetdkrplv

SCOP Domain Coordinates for d1k32d3:

Click to download the PDB-style file with coordinates for d1k32d3.
(The format of our PDB-style files is described here.)

Timeline for d1k32d3: