Lineage for d1k32d2 (1k32 D:39-319)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 114090Fold b.68: 6-bladed beta-propeller [50938] (7 superfamilies)
  4. 114229Superfamily b.68.7: Tricorn protease N-terminal domain [69304] (1 family) (S)
  5. 114230Family b.68.7.1: Tricorn protease N-terminal domain [69305] (1 protein)
  6. 114231Protein Tricorn protease N-terminal domain [69306] (1 species)
  7. 114232Species Archaeon Thermoplasma acidophilum [TaxId:2303] [69307] (1 PDB entry)
  8. 114236Domain d1k32d2: 1k32 D:39-319 [68081]
    Other proteins in same PDB: d1k32a1, d1k32a3, d1k32a4, d1k32b1, d1k32b3, d1k32b4, d1k32c1, d1k32c3, d1k32c4, d1k32d1, d1k32d3, d1k32d4, d1k32e1, d1k32e3, d1k32e4, d1k32f1, d1k32f3, d1k32f4

Details for d1k32d2

PDB Entry: 1k32 (more details), 2 Å

PDB Description: Crystal structure of the tricorn protease

SCOP Domain Sequences for d1k32d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k32d2 b.68.7.1 (D:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum}
mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
ntdgrrilfskggsiyifnpdtekiekieigdlespedrii

SCOP Domain Coordinates for d1k32d2:

Click to download the PDB-style file with coordinates for d1k32d2.
(The format of our PDB-style files is described here.)

Timeline for d1k32d2: