Lineage for d1k32c4 (1k32 C:680-762,C:854-1061)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461308Family c.14.1.2: Tail specific protease, catalytic domain [52100] (3 proteins)
    includes N-terminal all-alpha subdomain
  6. 2461318Protein Tricorn protease [69436] (1 species)
  7. 2461319Species Thermoplasma acidophilum [TaxId:2303] [69437] (4 PDB entries)
  8. 2461322Domain d1k32c4: 1k32 C:680-762,C:854-1061 [68079]
    Other proteins in same PDB: d1k32a1, d1k32a2, d1k32a3, d1k32b1, d1k32b2, d1k32b3, d1k32c1, d1k32c2, d1k32c3, d1k32d1, d1k32d2, d1k32d3, d1k32e1, d1k32e2, d1k32e3, d1k32f1, d1k32f2, d1k32f3

Details for d1k32c4

PDB Entry: 1k32 (more details), 2 Å

PDB Description: Crystal structure of the tricorn protease
PDB Compounds: (C:) tricorn protease

SCOPe Domain Sequences for d1k32c4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k32c4 c.14.1.2 (C:680-762,C:854-1061) Tricorn protease {Thermoplasma acidophilum [TaxId: 2303]}
ssiheeflqmydeawklardnywneavakeiseriyekyrnlvplcktrydlsnvivemq
geyrtshsyemggtftdkdpfrsXddrfiryrswveanrryvherskgtigyihipdmgm
mglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptn
svrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqp
efafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidalieelrn

SCOPe Domain Coordinates for d1k32c4:

Click to download the PDB-style file with coordinates for d1k32c4.
(The format of our PDB-style files is described here.)

Timeline for d1k32c4: