Lineage for d1k32a3 (1k32 A:320-679)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 114239Fold b.69: 7-bladed beta-propeller [50964] (9 superfamilies)
  4. 114347Superfamily b.69.9: Tricorn protease N-terminal domain [69322] (1 family) (S)
  5. 114348Family b.69.9.1: Tricorn protease N-terminal domain [69323] (1 protein)
  6. 114349Protein Tricorn protease N-terminal domain [69324] (1 species)
  7. 114350Species Archaeon Thermoplasma acidophilum [TaxId:2303] [69325] (1 PDB entry)
  8. 114351Domain d1k32a3: 1k32 A:320-679 [68070]
    Other proteins in same PDB: d1k32a1, d1k32a2, d1k32a4, d1k32b1, d1k32b2, d1k32b4, d1k32c1, d1k32c2, d1k32c4, d1k32d1, d1k32d2, d1k32d4, d1k32e1, d1k32e2, d1k32e4, d1k32f1, d1k32f2, d1k32f4

Details for d1k32a3

PDB Entry: 1k32 (more details), 2 Å

PDB Description: Crystal structure of the tricorn protease

SCOP Domain Sequences for d1k32a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum}
sipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafih
gtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfavvandrfeimtvdletgkpt
viersreamitdftisdnsrfiaygfplkhgetdgyvmqaihvydmegrkifaattensh
dyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpfviplipgspnptklvprsm
tseageydlndmykrsspinvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvl
lkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytfplekpedertvetdkrplv

SCOP Domain Coordinates for d1k32a3:

Click to download the PDB-style file with coordinates for d1k32a3.
(The format of our PDB-style files is described here.)

Timeline for d1k32a3: