Lineage for d1k30a1 (1k30 A:4-368)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150072Fold c.112: Glycerol-3-phosphate (1)-acyltransferase [69592] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 9 strands, order 918736452; strands 1, 2 and 8 are antiparallel to the rest
  4. 2150073Superfamily c.112.1: Glycerol-3-phosphate (1)-acyltransferase [69593] (1 family) (S)
    some topological similarity to the dihydrofolate reductase fold
  5. 2150074Family c.112.1.1: Glycerol-3-phosphate (1)-acyltransferase [69594] (1 protein)
  6. 2150075Protein Glycerol-3-phosphate (1)-acyltransferase [69595] (1 species)
  7. 2150076Species Cushaw squash (Cucurbita moschata) [TaxId:3662] [69596] (2 PDB entries)
  8. 2150078Domain d1k30a1: 1k30 A:4-368 [68067]
    Other proteins in same PDB: d1k30a2

Details for d1k30a1

PDB Entry: 1k30 (more details), 1.9 Å

PDB Description: Crystal Structure Analysis of Squash (Cucurbita moschata) glycerol-3-phosphate (1)-acyltransferase
PDB Compounds: (A:) glycerol-3-phosphate acyltransferase

SCOPe Domain Sequences for d1k30a1:

Sequence, based on SEQRES records: (download)

>d1k30a1 c.112.1.1 (A:4-368) Glycerol-3-phosphate (1)-acyltransferase {Cushaw squash (Cucurbita moschata) [TaxId: 3662]}
hsrkfldvrseeellscikketeagklppnvaagmeelyqnyrnaviesgnpkadeivls
nmtvaldrilldvedpfvfsshhkairepfdyyifgqnyirplidfgnsfvgnlslfkdi
eeklqqghnvvlisnhqteadpaiislllektnpyiaentifvagdrvladplckpfsig
rnlicvyskkhmfdipeltetkrkantrslkemalllrggsqliwiapsggrdrpdpstg
ewypapfdassvdnmrrliqhsdvpghlfplallchdimpppsqveieigekrviafnga
glsvapeisfeeiaathknpeevreayskalfdsvamqynvlktaisgkqglgastadvs
lsqpw

Sequence, based on observed residues (ATOM records): (download)

>d1k30a1 c.112.1.1 (A:4-368) Glycerol-3-phosphate (1)-acyltransferase {Cushaw squash (Cucurbita moschata) [TaxId: 3662]}
hsrkfldvrseeellscikketeagklppnvaagmeelyqnyrnaviesgnpkadeivls
nmtvaldrilldvedpfvfsshhkairepfdyyifgqnyirplidfgnsfvgnlslfkdi
eeklqqghnvvlisnhqteadpaiislllektnpyiaentifvagdrvladplckpfsig
rnlicvyskkhmfdipeltetkrkantrslkemalllrggsqliwiapsggrdrpdpstg
ewypapfdassvdnmrrliqhsdvpghlfplallchdimpppsqveieirviafngagls
vapeisfeeiaathknpeevreayskalfdsvamqynvlktaisgkqglgastadvslsq
pw

SCOPe Domain Coordinates for d1k30a1:

Click to download the PDB-style file with coordinates for d1k30a1.
(The format of our PDB-style files is described here.)

Timeline for d1k30a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k30a2