Lineage for d1k2yx3 (1k2y X:259-367)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) 
Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins) Protein Phosphomannomutase/phosphoglucomutase [69607] (1 species) Species Pseudomonas aeruginosa [TaxId:287] [69608] (2 PDB entries) 
Domain d1k2yx3: 1k2y X:259-367 [68065]
Details for d1k2yx3
PDB Entry: 1k2y (more details), 1.75 Å
PDB Description: crystal structure of phosphomannomutase/phosphoglucomutase s108a mutant from p. aeruginosa
SCOP Domain Sequences for d1k2yx3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k2yx3 c.84.1.1 (X:259-367) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa}
ypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggrpvmwktghslikkkmket
gallagemsghvffkerwfgfddgiysaarlleilsqdqrdsehvfsaf
SCOP Domain Coordinates for d1k2yx3:
Click to download the PDB-style file with coordinates for d1k2yx3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k2yx3:
- d1k2yx3 is new in SCOP 1.59
- d1k2yx3 appears in SCOP 1.61
- d1k2yx3 appears in the current release, SCOPe 2.08
View in 3D
