![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
![]() | Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) ![]() |
![]() | Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins) |
![]() | Protein Phosphomannomutase/phosphoglucomutase [69607] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [69608] (12 PDB entries) |
![]() | Domain d1k2yx2: 1k2y X:155-258 [68064] Other proteins in same PDB: d1k2yx4 |
PDB Entry: 1k2y (more details), 1.75 Å
SCOP Domain Sequences for d1k2yx2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k2yx2 c.84.1.1 (X:155-258) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]} ilpryfkqirddiamakpmkvvvdcgngvagviapqliealgcsviplycevdgnfpnhh pdpgkpenlkdliakvkaenadlglafdgdgdrvgvvtntgtii
Timeline for d1k2yx2: