Lineage for d1k2yx1 (1k2y X:5-154)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2517507Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2517508Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2517509Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)
  6. 2517562Protein Phosphomannomutase/phosphoglucomutase [69607] (1 species)
  7. 2517563Species Pseudomonas aeruginosa [TaxId:287] [69608] (12 PDB entries)
  8. 2517570Domain d1k2yx1: 1k2y X:5-154 [68063]
    Other proteins in same PDB: d1k2yx4
    complexed with tla, zn; mutant

Details for d1k2yx1

PDB Entry: 1k2y (more details), 1.75 Å

PDB Description: crystal structure of phosphomannomutase/phosphoglucomutase s108a mutant from p. aeruginosa
PDB Compounds: (X:) Phosphomannomutase

SCOPe Domain Sequences for d1k2yx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k2yx1 c.84.1.1 (X:5-154) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]}
kaptlpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpel
vkqliqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgahnppdyngfkivvage
tlaneqiqalreriekndlasgvgsveqvd

SCOPe Domain Coordinates for d1k2yx1:

Click to download the PDB-style file with coordinates for d1k2yx1.
(The format of our PDB-style files is described here.)

Timeline for d1k2yx1: