Lineage for d1k2oa_ (1k2o A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284545Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 284546Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 284547Family a.104.1.1: Cytochrome P450 [48265] (14 proteins)
  6. 284607Protein Cytochrome P450-CAM [48266] (1 species)
  7. 284608Species Pseudomonas putida [TaxId:303] [48267] (40 PDB entries)
  8. 284620Domain d1k2oa_: 1k2o A: [68061]

Details for d1k2oa_

PDB Entry: 1k2o (more details), 1.65 Å

PDB Description: cytochrome p450cam with bound bis(2,2'-bipyridine)-(5-methyl-2-2'- bipyridine)-c2-adamantane ruthenium (ii)

SCOP Domain Sequences for d1k2oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k2oa_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida}
anlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrg
qlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdkle
nriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpd
gsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvg
gldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefh
gvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreii
vtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOP Domain Coordinates for d1k2oa_:

Click to download the PDB-style file with coordinates for d1k2oa_.
(The format of our PDB-style files is described here.)

Timeline for d1k2oa_: