Lineage for d1k2i1_ (1k2i 1:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 111585Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 111670Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins)
  6. 111671Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (2 species)
  7. 111672Species Cow (Bos taurus) [TaxId:9913] [50523] (45 PDB entries)
  8. 111679Domain d1k2i1_: 1k2i 1: [68058]

Details for d1k2i1_

PDB Entry: 1k2i (more details), 1.8 Å

PDB Description: Crystal Structure of Gamma-Chymotrypsin in Complex with 7-Hydroxycoumarin

SCOP Domain Sequences for d1k2i1_:

Sequence, based on SEQRES records: (download)

>d1k2i1_ b.47.1.2 (1:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
tlaan

Sequence, based on observed residues (ATOM records): (download)

>d1k2i1_ b.47.1.2 (1:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvlivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsdv
vvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclps
asddfaagttcvttgwgltrytpdrlqqaslpllsntnckkywgtkikdamicagasgvs
scmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

SCOP Domain Coordinates for d1k2i1_:

Click to download the PDB-style file with coordinates for d1k2i1_.
(The format of our PDB-style files is described here.)

Timeline for d1k2i1_: