Lineage for d1k2ha_ (1k2h A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97344Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 97345Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 97368Family a.39.1.2: S100 proteins [47478] (1 protein)
  6. 97369Protein Calcyclin (S100) [47479] (11 species)
  7. 97412Species Rat (Rattus norvegicus), s100a1 [TaxId:10116] [69019] (1 PDB entry)
  8. 97413Domain d1k2ha_: 1k2h A: [68056]

Details for d1k2ha_

PDB Entry: 1k2h (more details)

PDB Description: three-dimensional solution structure of apo-s100a1.
PDB Compounds: (A:)

SCOP Domain Sequences for d1k2ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k2ha_ a.39.1.2 (A:) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1}
gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
ldengdgevdfqefvvlvaaltvacnnffwens

SCOP Domain Coordinates for d1k2ha_:

Click to download the PDB-style file with coordinates for d1k2ha_.
(The format of our PDB-style files is described here.)

Timeline for d1k2ha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1k2hb_