Lineage for d1k2fa_ (1k2f A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776288Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1776289Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 1776374Family b.8.1.2: SIAH, seven in absentia homolog [69198] (2 proteins)
    automatically mapped to Pfam PF03145
  6. 1776375Protein SIAH, seven in absentia homolog [69199] (1 species)
  7. 1776376Species Mouse (Mus musculus) [TaxId:10090] [69200] (2 PDB entries)
  8. 1776377Domain d1k2fa_: 1k2f A: [68054]
    complexed with bme, zn

Details for d1k2fa_

PDB Entry: 1k2f (more details), 2.6 Å

PDB Description: siah, Seven In Absentia Homolog
PDB Compounds: (A:) siah-1A protein

SCOPe Domain Sequences for d1k2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k2fa_ b.8.1.2 (A:) SIAH, seven in absentia homolog {Mouse (Mus musculus) [TaxId: 10090]}
svlfpckyassgceitlphtekaeheelcefrpyscpcpgasckwqgsldavmphlmhqh
ksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekydghqqffaivqli
gtrkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaengn
lginvtismc

SCOPe Domain Coordinates for d1k2fa_:

Click to download the PDB-style file with coordinates for d1k2fa_.
(The format of our PDB-style files is described here.)

Timeline for d1k2fa_: