Lineage for d1k2fa_ (1k2f A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 458529Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 458530Superfamily b.8.1: TRAF domain-like [49599] (2 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 458596Family b.8.1.2: SIAH, seven in absentia homolog [69198] (1 protein)
  6. 458597Protein SIAH, seven in absentia homolog [69199] (1 species)
  7. 458598Species Mouse (Mus musculus) [TaxId:10090] [69200] (1 PDB entry)
  8. 458599Domain d1k2fa_: 1k2f A: [68054]

Details for d1k2fa_

PDB Entry: 1k2f (more details), 2.6 Å

PDB Description: siah, Seven In Absentia Homolog

SCOP Domain Sequences for d1k2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k2fa_ b.8.1.2 (A:) SIAH, seven in absentia homolog {Mouse (Mus musculus)}
svlfpckyassgceitlphtekaeheelcefrpyscpcpgasckwqgsldavmphlmhqh
ksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekydghqqffaivqli
gtrkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaengn
lginvtismc

SCOP Domain Coordinates for d1k2fa_:

Click to download the PDB-style file with coordinates for d1k2fa_.
(The format of our PDB-style files is described here.)

Timeline for d1k2fa_: