SCOP 1.71: Domain d1k28d2: 1k28 D:201-376

Lineage for d1k28d2 (1k28 D:201-376)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.106: Phage tail proteins [69278] (1 superfamily)
   core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel

4. Superfamily b.106.1: Phage tail proteins [69279] (2 families)

5. Family b.106.1.1: Baseplate structural protein gp27 [69280] (1 protein)
   duplication: consists of two similar barrel domains that differ by the first strand directions; the barrels are differently decorated by alpha+beta insertions

6. Protein Baseplate structural protein gp27 [69281] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [69282] (1 PDB entry)

8. Domain d1k28d2: 1k28 D:201-376 [68053]
   Other proteins in same PDB: d1k28a1, d1k28a2, d1k28a3
   complexed with k, po4

Details for d1k28d2

PDB Entry: 1k28, 2.9 Å

PDB Description: The Structure of the Bacteriophage T4 Cell-Puncturing Device

SCOP Domain Sequences for d1k28d2:

Sequence, based on SEQRES records:

>d1k28d2 b.106.1.1 (D:201-376) Baseplate structural protein gp27 {Bacteriophage T4}
dmminqepypmivgepsligqfiqelkyplaydfvwltksnphkrdpmknatiyahsfld
ssipmittgkgensivvsrsgaysemtyrngyeeairlqtmaqydgyakcstignfnltp
gvkiifndsknqfktefyvdevihelsnnnsvthlymftnatkletidpvkvknef

Sequence, based on observed residues (ATOM records):

>d1k28d2 b.106.1.1 (D:201-376) Baseplate structural protein gp27 {Bacteriophage T4}
dmminqepypmivgepskyplaydfvwltksnphkrdpmknatiyahsfldssipmittg
kgensivvsrsgaysemtyrngyeeairlqtmaqydgyakcstignfnltpgvkiifnds
knqfktefyvdevihelsnnnsvthlymftnatkletidpvkvknef

Timeline for d1k28d2:

• d1k28d2 first appeared in SCOP 1.59
  
• d1k28d2 appears in SCOP 1.69
  
• d1k28d2 appears in SCOP 1.73
  
• d1k28d2 appears in the current release, SCOPe 2.08