Lineage for d1k28d1 (1k28 D:4-200)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 115852Fold b.106: Baseplate structural protein gp27 [69278] (1 superfamily)
  4. 115853Superfamily b.106.1: Baseplate structural protein gp27 [69279] (1 family) (S)
  5. 115854Family b.106.1.1: Baseplate structural protein gp27 [69280] (1 protein)
  6. 115855Protein Baseplate structural protein gp27 [69281] (1 species)
  7. 115856Species Bacteriophage T4 [TaxId:10665] [69282] (1 PDB entry)
  8. 115857Domain d1k28d1: 1k28 D:4-200 [68052]
    Other proteins in same PDB: d1k28a1, d1k28a2, d1k28a3

Details for d1k28d1

PDB Entry: 1k28 (more details), 2.9 Å

PDB Description: The Structure of the Bacteriophage T4 Cell-Puncturing Device

SCOP Domain Sequences for d1k28d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k28d1 b.106.1.1 (D:4-200) Baseplate structural protein gp27 {Bacteriophage T4}
lqrpgypnlsvklfdsydawsnnrfvelaatittltmrdslygrnegmlqfydsknihtk
mdgneiiqisvanandinnvktriygckhfsvsvdskgdniiaielgtihsienlkfgrp
ffpdagesikemlgviyqdrtlltpainainayvpdipwtstfenylsyvrevalavgsd
kfvfvwqdimgvnmmdy

SCOP Domain Coordinates for d1k28d1:

Click to download the PDB-style file with coordinates for d1k28d1.
(The format of our PDB-style files is described here.)

Timeline for d1k28d1: