Lineage for d1k28d1 (1k28 D:4-200)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820941Fold b.106: Phage tail proteins [69278] (1 superfamily)
    core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel
  4. 2820942Superfamily b.106.1: Phage tail proteins [69279] (4 families) (S)
  5. 2820943Family b.106.1.1: Baseplate protein-like [69280] (4 proteins)
    duplication: consists of two similar barrel domains that differ by the first strand directions; the barrels are differently decorated by alpha+beta insertions
  6. 2820970Protein Baseplate structural protein gp27 [69281] (1 species)
  7. 2820971Species Bacteriophage T4 [TaxId:10665] [69282] (3 PDB entries)
  8. 2820972Domain d1k28d1: 1k28 D:4-200 [68052]
    Other proteins in same PDB: d1k28a1, d1k28a2, d1k28a3, d1k28a4
    complexed with k, po4

Details for d1k28d1

PDB Entry: 1k28 (more details), 2.9 Å

PDB Description: The Structure of the Bacteriophage T4 Cell-Puncturing Device
PDB Compounds: (D:) Baseplate structural protein Gp27

SCOPe Domain Sequences for d1k28d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k28d1 b.106.1.1 (D:4-200) Baseplate structural protein gp27 {Bacteriophage T4 [TaxId: 10665]}
lqrpgypnlsvklfdsydawsnnrfvelaatittltmrdslygrnegmlqfydsknihtk
mdgneiiqisvanandinnvktriygckhfsvsvdskgdniiaielgtihsienlkfgrp
ffpdagesikemlgviyqdrtlltpainainayvpdipwtstfenylsyvrevalavgsd
kfvfvwqdimgvnmmdy

SCOPe Domain Coordinates for d1k28d1:

Click to download the PDB-style file with coordinates for d1k28d1.
(The format of our PDB-style files is described here.)

Timeline for d1k28d1: