SCOPe 2.08: Domain d1k28a2: 1k28 A:362-576

Lineage for d1k28a2 (1k28 A:362-576)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily)
   (homo)trimer; each chain donates 3 beta-strands per turn of the helix

4. Superfamily b.108.1: Phage fibre proteins [69349] (6 families)

5. Family b.108.1.2: Tail-associated lysozyme gp5, C-terminal domain [69353] (1 protein)

6. Protein Tail-associated lysozyme gp5, C-terminal domain [69354] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [69355] (1 PDB entry)

8. Domain d1k28a2: 1k28 A:362-576 [68050]
   Other proteins in same PDB: d1k28a1, d1k28a3, d1k28a4, d1k28d1, d1k28d2
   dN: 761-312; dI: 424-506
   complexed with k, po4

Details for d1k28a2

PDB Entry: 1k28, 2.9 Å

PDB Description: The Structure of the Bacteriophage T4 Cell-Puncturing Device

PDB Compounds: (A:) Tail-associated lysozyme

SCOPe Domain Sequences for d1k28a2:

Sequence; same for both SEQRES and ATOM records:

>d1k28a2 b.108.1.2 (A:362-576) Tail-associated lysozyme gp5, C-terminal domain {Bacteriophage T4 [TaxId: 10665]}
dpadppipndsrilfkepvssykgeypyvhtmetesghiqefddtpgqeryrlvhptgty
eevspsgrrtrktvdnlyditnadgnflvagdkktnvggseiyynmdnrlhqidgsntif
vrgdetktvegngtilvkgnvtiivegnaditvkgdattlvegnqtntvngnlswkvagt
vdwdvggdwtekmasmssissgqytidgsridigs

Timeline for d1k28a2:

• d1k28a2 first appeared in SCOP 1.59
  
• d1k28a2 appears in SCOPe 2.07