Lineage for d1k28a2 (1k28 A:362-576)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821021Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily)
    (homo)trimer; each chain donates 3 beta-strands per turn of the helix
  4. 2821022Superfamily b.108.1: Phage fibre proteins [69349] (6 families) (S)
  5. 2821027Family b.108.1.2: Tail-associated lysozyme gp5, C-terminal domain [69353] (1 protein)
  6. 2821028Protein Tail-associated lysozyme gp5, C-terminal domain [69354] (1 species)
  7. 2821029Species Bacteriophage T4 [TaxId:10665] [69355] (1 PDB entry)
  8. 2821030Domain d1k28a2: 1k28 A:362-576 [68050]
    Other proteins in same PDB: d1k28a1, d1k28a3, d1k28a4, d1k28d1, d1k28d2
    dN: 761-312; dI: 424-506
    complexed with k, po4

Details for d1k28a2

PDB Entry: 1k28 (more details), 2.9 Å

PDB Description: The Structure of the Bacteriophage T4 Cell-Puncturing Device
PDB Compounds: (A:) Tail-associated lysozyme

SCOPe Domain Sequences for d1k28a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k28a2 b.108.1.2 (A:362-576) Tail-associated lysozyme gp5, C-terminal domain {Bacteriophage T4 [TaxId: 10665]}
dpadppipndsrilfkepvssykgeypyvhtmetesghiqefddtpgqeryrlvhptgty
eevspsgrrtrktvdnlyditnadgnflvagdkktnvggseiyynmdnrlhqidgsntif
vrgdetktvegngtilvkgnvtiivegnaditvkgdattlvegnqtntvngnlswkvagt
vdwdvggdwtekmasmssissgqytidgsridigs

SCOPe Domain Coordinates for d1k28a2:

Click to download the PDB-style file with coordinates for d1k28a2.
(The format of our PDB-style files is described here.)

Timeline for d1k28a2: